General Information

  • ID:  hor005633
  • Uniprot ID:  Q8UW82
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Verasper moseri (Barfin flounder)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Brain; ventromedial olfactory bulbs and terminal nerve ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Verasper (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGELEATIRMMGTGGVVSLPEEASAQTQERPRPYNVIDDGSRHFHRKKRFPDN
  • Length:  54
  • Propeptide:  MEASSRLVVQVLVLMLVVQVALSQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERPRPYNVIDDGSRHFHRKKRFPDN
  • Signal peptide:  MEASSRLVVQVLVLMLVVQVALS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9IA09-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005633_AF2.pdbhor005633_ESM.pdb

Physical Information

Mass: 701426 Formula: C259H414N82O83S2
Absent amino acids: CW Common amino acids: REG
pI: 7.71 Basic residues: 10
Polar residues: 15 Hydrophobic residues: 13
Hydrophobicity: -92.59 Boman Index: -15933
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.93
Instability Index: 3960.37 Extinction Coefficient cystines: 1490
Absorbance 280nm: 28.11

Literature

  • PubMed ID:  12093120
  • Title:  Molecular cloning of three cDNAs encoding different GnRHs in the brain of barfin flounder.